PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_07243
Common NameKK1_007445
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family LBD
Protein Properties Length: 217aa    MW: 23632.2 Da    PI: 6.8668
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_07243genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-42641631100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+a+la+
  C.cajan_07243  64 PCAACKILRRRCVEKCVLAPYFPPTDPIKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQAQLAK 159
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  C.cajan_07243 160 AQAE 163
                    9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.94563164IPR004883Lateral organ boundaries, LOB
PfamPF031959.0E-4364161IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MEYKVKTTTT SPPIPIHVPT MLSNSPPSSS SSPPSQSHTP FPSPSQGSPP AAPPSPPPPV  60
VVSPCAACKI LRRRCVEKCV LAPYFPPTDP IKFTIAHRVF GASNIIKFLQ ELPESQRADA  120
VSSMVYEANA RIRDPVYGCA GAICQLQKQV SELQAQLAKA QAEVVNMQCQ QANLVALICM  180
EMSQSQDQNM LQPQPHVDMS CFIEDNTFGT AWEPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0991130.0BT099113.1 Soybean clone JCVI-FLGm-13B15 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556215.11e-117PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR07e-78LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A151U6371e-158A0A151U637_CAJCA; LOB domain-containing protein 1
STRINGGLYMA20G31780.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-65LOB domain-containing protein 1